General Information

  • ID:  hor003207
  • Uniprot ID:  A0A8V0Y7A6(132-170)
  • Protein name:  Adrenocorticotropic
  • Gene name:  POMC
  • Organism:  Gallus gallus (Chicken)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPIKVYPNGVDEESAESYPMEF
  • Length:  39(132-170)
  • Propeptide:  MRGALCHSLPVVLGLLLCHPTTASGPCWENSKCQDLATEAGVLACAKACRAELSAEAPVYLGNGHLQPLSESIRKYVMSHFRWNKFGRRNSSSGGHKREEVAGLALPAASPHHPAGEEEDGEGLEREEGKRSYSMEHFRWGKPVGRKRRPIKVYPNGVDEESAESYPMEFRREMAPDGDPFGLSEEEEEEEEEEGEEEKKDGGSYRMRHFRWHAPLKDKRYGGFMSLEHSQTPLMTLFKNAIVKSAYKKGQ
  • Signal peptide:  MRGALCHSLPVVLGLLLCHPTTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003207_AF2.pdbhor003207_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 533917 Formula: C209H312N58O60S2
Absent amino acids: CLQT Common amino acids: E
pI: 9.02 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -114.62 Boman Index: -10976
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 34.87
Instability Index: 5245.13 Extinction Coefficient cystines: 9970
Absorbance 280nm: 262.37

Literature

  • PubMed ID:  1652532
  • Title:  Characterization of Chicken ACTH and alpha-MSH: The Primary Sequence of Chicken ACTH Is More Similar to Xenopus ACTH Than to Other Avian ACTH